Protein Info for HP15_3980 in Marinobacter adhaerens HP15

Annotation: diguanylate cyclase/phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 709 TIGR00229: PAS domain S-box protein" amino acids 18 to 137 (120 residues), 50.6 bits, see alignment E=2.1e-17 amino acids 144 to 261 (118 residues), 71.4 bits, see alignment E=7.3e-24 PF13188: PAS_8" amino acids 18 to 57 (40 residues), 21.6 bits, see alignment 5.6e-08 amino acids 144 to 181 (38 residues), 27.3 bits, see alignment 8.6e-10 PF00989: PAS" amino acids 25 to 125 (101 residues), 31.9 bits, see alignment E=4.2e-11 amino acids 146 to 225 (80 residues), 36.9 bits, see alignment E=1.2e-12 PF08448: PAS_4" amino acids 26 to 133 (108 residues), 39.2 bits, see alignment E=2.5e-13 PF13426: PAS_9" amino acids 30 to 131 (102 residues), 49.9 bits, see alignment E=1.1e-16 amino acids 151 to 253 (103 residues), 59.2 bits, see alignment E=1.5e-19 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 261 to 422 (162 residues), 146.8 bits, see alignment E=4.9e-47 PF00990: GGDEF" amino acids 265 to 419 (155 residues), 165.9 bits, see alignment E=2.3e-52 PF00563: EAL" amino acids 440 to 673 (234 residues), 219 bits, see alignment E=2.1e-68

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKS2 at UniProt or InterPro

Protein Sequence (709 amino acids)

>HP15_3980 diguanylate cyclase/phosphodiesterase (Marinobacter adhaerens HP15)
MPRSPTTITPPSDIDPKRLAMVAAATPNFLVMLDDAGRIEWVNPSFEEHTGYQLEEVRGC
LPKEVLYGPDTDPETIKRINQKLHRAEIIEEDILHYTKAGQPYWVHTYCVPIGTEQGVAP
GYIAIQNNISDRKNSERGLRIAASVFDRSHEAILITDQSNRILDVNPAFSRITGYSRQEV
LGLNPAILSSGRHSGAYYRSMWRTIEKTDHWRGEIWNRRKNGEEFVELLSISRVHLEEPG
QYYHVAAFSDITALKNHARELDRAANYDDLTGLPNRQLLEERLRTARSHADRQHRSVSVC
YLDLDGFKGINDKWGQSAGDQTLRTLAERLTRALRSGDTVARIGGDEFVLLLQGDDNHEA
VYQRILATVGDPVTVGDQNVSLTASLGITRYPEDGSDAEGLIRHADQAMYSAKEKGRNQY
HLFDPGLDEHRRNRRNQLMEISRALENEEFELFSSPRSVSRIANFSVLRRIRWNHPQKGL
VSPGEFLPIVENSHLEVPLGQWVLKEAIHQMNAWKEAGENLAISINISAPHLMDRSFADY
LESYLHSHPEVAPGQITLEVLESTALEDTQRASNVLARCQSLGLQVALDDFGTGFSSLTY
LRTLPVDIIKIDQSFVRNMLEDAGDRAIVESVIFLAQRFAHPVLAEGVETMEHARTLRQM
GCNFVQGYGIARPMPAAEVLGWARKWQHRARSGKAGDLLSTAVASGKGL