Protein Info for Psest_0405 in Pseudomonas stutzeri RCH2

Annotation: Phytoene/squalene synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 57% identical to CRTB_ESCVU: Phytoene synthase (crtB) from Escherichia vulneris

KEGG orthology group: K02291, phytoene synthase [EC: 2.5.1.32] (inferred from 94% identity to psa:PST_3872)

Predicted SEED Role

"Phytoene synthase (EC 2.5.1.32)" in subsystem Carotenoids (EC 2.5.1.32)

MetaCyc Pathways

neurosporene biosynthesis (2/5 steps found)
β-carotene biosynthesis (engineered) (4/8 steps found)
trans-lycopene biosynthesis I (2/6 steps found)
trans-lycopene biosynthesis II (oxygenic phototrophs and green sulfur bacteria) (3/8 steps found)
lycopadiene biosynthesis (1/7 steps found)
superpathway of carotenoid biosynthesis in plants (7/22 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGA4 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Psest_0405 Phytoene/squalene synthetase (Pseudomonas stutzeri RCH2)
MNDRVIDHSTQAINVGSKSFAAAAKLFDERTRQSAVMLYAWCRHCDDVIDGQTLGHGQLA
GDRNSGEARLAELVDLTERAYAGEAMSDPAFAAFQQVVQRHQIPKRYPLEHLAGFRMDVQ
NYRYQTLDDTLLYCYRVAGVVGLMMARVMGAEAEPTLERACDLGLAFQLTNIARDIVEDA
QIGRVYLPAEWLAEVDIPEDEVALLQHRAALATLAVRLVNLAEPYYQSASQGLRDLPLRS
AWSIATAHGVYRQIGVEVKARGAAAWDRRVSTSKGQKLQFLLGGGVLALASRRMQVRPRP
DDLWRRPR