Protein Info for Psest_0404 in Pseudomonas stutzeri RCH2

Annotation: phytoene desaturase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02734: phytoene desaturase
  • amino acids 7 to 495 (489 residues), 741.8 bits, E=1.9e-227
• PF00890: FAD_binding_2
  • amino acids 7 to 41 (35 residues), 23.8 bits, 8.9e-09
• PF13450: NAD_binding_8
  • amino acids 9 to 70 (62 residues), 56.9 bits, E=7e-19
• PF01593: Amino_oxidase
  • amino acids 15 to 491 (477 residues), 160.8 bits, E=2.5e-50

Best Hits

Swiss-Prot: 72% identical to CRTI_PANAN: Phytoene desaturase (lycopene-forming) (crtI) from Pantoea ananas

KEGG orthology group: K10027, phytoene dehydrogenase [EC: 1.14.99.-] (inferred from 96% identity to psa:PST_3873)

MetaCyc: 72% identical to phytoene desaturase (lycopene-forming) (Pantoea ananatis)
RXN-12414 [EC: 1.3.99.31]

Predicted SEED Role

"Phytoene dehydrogenase (EC 1.14.99.-)" in subsystem Carotenoids (EC 1.14.99.-)

MetaCyc Pathways

• neurosporene biosynthesis (2/5 steps found)
• β-carotene biosynthesis (engineered) (4/8 steps found)
• trans-lycopene biosynthesis I (2/6 steps found)
• okenone biosynthesis (1/6 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Benzoate degradation via hydroxylation
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Naphthalene and anthracene degradation
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.99.- or 1.3.99.31

Sequence Analysis Tools

See L0GI03 at UniProt or InterPro

Protein Sequence (501 amino acids)

>Psest_0404 phytoene desaturase (Pseudomonas stutzeri RCH2)
MNQAKRAVVIGAGFGGLALAIRLQRAGIQTTLLEKRDKPGGRAYVYHDQGFTFDAGPTVI
TDPPALEELFSGAGKRMADYVELLPVSPFYRLCWEDGYSFDYVNDQVELDRQIHALNPKD
VAGYQRFLAYSRAVYEEGYVKLGTVPFLSFRSMIGVAPQLAKLQAWRNVYSMVAKFVEND
RLRQALSFHSLLVGGNPFETSSIYALIHALERQGGVWFPRGGTGALVQGMVRLFEDLGGK
LELNAEVARIDLAGGHAKAVITGDGRRFDTDAVASNADVVNTYKQLLGHEQRGRDEAKRL
SGKRFSMSLFVIHFGLKRRHEHLQHHTVCFGPRYRELIDEIFKRETLADDFSLYLHAPCV
TDPSLAPEGCASHYVLAPVPHLGTADIDWAVEGPKYRDRIFEYLERHYMPGLRGDLVTHR
IFTPLDFRDELNAHLGSAFSLEPILTQSAWFRPHNRDDVIPNLYIVGAGTHPGAGVPGVV
GSAKATAALMLEDFMLKEHAG