Protein Info for Psest_4101 in Pseudomonas stutzeri RCH2

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02129: Peptidase_S15" amino acids 48 to 293 (246 residues), 24.1 bits, see alignment E=8.5e-09 PF00561: Abhydrolase_1" amino acids 63 to 298 (236 residues), 124.7 bits, see alignment E=1.6e-39 PF12146: Hydrolase_4" amino acids 64 to 164 (101 residues), 52.7 bits, see alignment E=1.2e-17 PF12697: Abhydrolase_6" amino acids 67 to 306 (240 residues), 77 bits, see alignment E=1.1e-24 PF00326: Peptidase_S9" amino acids 234 to 316 (83 residues), 26.2 bits, see alignment E=1.7e-09

Best Hits

Swiss-Prot: 72% identical to PRXC_PSEFL: Non-heme chloroperoxidase (cpo) from Pseudomonas fluorescens

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 90% identity to psa:PST_0170)

Predicted SEED Role

"Similar to non-heme chloroperoxidase, sll5080 homolog" in subsystem Synechocystis experimental

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRF4 at UniProt or InterPro

Protein Sequence (316 amino acids)

>Psest_4101 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Pseudomonas stutzeri RCH2)
MNAIIRTFTLPLLAIAMQPVFAAQPEQATQPTSGVASARTASTITTADGVQLYYKDWGPK
DGPVVTFSHGWPLNSDSWESQMLFLASEGYRVVAHDRRGHGRSSQPWEGNDMDHYADDLA
AVIEALDLKDVTLVGFSTGGGEVARYIGRQGTERIKKAVLVSAVPPMMLKTADNPGGLPL
EVFDGIRKASLEDRAQLYLDLASGPFYGFNRSGAKVSQGLIDNWRAQGLQAGHKNTYDSI
AAFSATDFRGDLKKFDVPTLVIHGDDDQIVPLDSSGKASAALVKGAKLIVYPGAPHGLTD
THKERFNNDLLAFLKE