Protein Info for HP15_3967 in Marinobacter adhaerens HP15

Annotation: integral membrane sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details PF26769: HAMP_PhoQ" amino acids 198 to 242 (45 residues), 28.5 bits, see alignment 1.9e-10 PF00512: HisKA" amino acids 248 to 307 (60 residues), 47.9 bits, see alignment E=1.7e-16 PF02518: HATPase_c" amino acids 357 to 462 (106 residues), 74.8 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: K07645, two-component system, OmpR family, sensor histidine kinase QseC [EC: 2.7.13.3] (inferred from 85% identity to maq:Maqu_0285)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKQ9 at UniProt or InterPro

Protein Sequence (470 amino acids)

>HP15_3967 integral membrane sensor signal transduction histidine kinase (Marinobacter adhaerens HP15)
MSLTRKLILLITSTVFFITLIAAGWGFYVSDHQLEELFDAELAQSTRIVQGLVEHLSSTQ
SMEQISHTLEKTLQLPDGVYQGDEEENEILPGGAGHKYERKLAFEVWSPDREPILDTLRA
NDSQGLERGFGWQEVAGYQWRTFTLEDPATGFWIRTAQREDVRDELSQEIALGNVLPFLI
VLPVLALAVLVSIQVGFQPLRKLEKPVRNMAPENIHPLDDRQAPKEVAGLVQAVNGLLRR
LNQALERERRFSADAAHELRTPLTALRLNLEKVYENDPEQYGDLIQSVDRMVHLVEQMLL
LNRVDSGADFTPEYHNLSAIVEQSIADVAPLALKKDIDPVLQDDAGQALVSCHSALINTL
MRSLLANAIQYSPEHTSIETHLTPAGEGYHITVCDQGPGIPAEARERALSRFVRLDQRLG
GGAGLGLAIARRIAELHGGQLTLGDRPDGNSGLCVSIWLPARATSRLKKV