Protein Info for Psest_0403 in Pseudomonas stutzeri RCH2

Annotation: lycopene cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05834: Lycopene_cycl
  • amino acids 6 to 373 (368 residues), 312.7 bits, E=1.9e-97
• TIGR01790: lycopene cyclase family protein
  • amino acids 6 to 372 (367 residues), 341.2 bits, E=9.1e-106
• TIGR01789: lycopene cyclase
  • amino acids 6 to 375 (370 residues), 505.9 bits, E=6.8e-156

Best Hits

Swiss-Prot: 57% identical to CRTY_ESCVU: Lycopene beta-cyclase (crtY) from Escherichia vulneris

KEGG orthology group: K06443, lycopene beta cyclase [EC: 1.14.-.-] (inferred from 82% identity to psa:PST_3874)

MetaCyc: 57% identical to lycopene beta-cyclase (Pantoea ananatis)
RXN-12496 [EC: 5.5.1.19]; 5.5.1.19 [EC: 5.5.1.19]; 5.5.1.19 [EC: 5.5.1.19]

Predicted SEED Role

"Lycopene cyclase" in subsystem Carotenoids

MetaCyc Pathways

• β-carotene biosynthesis (2/2 steps found)
• chlorobactene biosynthesis (1/2 steps found)
• isorenieratene biosynthesis I (actinobacteria) (2/4 steps found)
• β-carotene biosynthesis (engineered) (4/8 steps found)
• okenone biosynthesis (1/6 steps found)
• superpathway of carotenoid biosynthesis in plants (7/22 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Ascorbate and aldarate metabolism
• Benzoxazinone biosynthesis
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of steroids
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Limonene and pinene degradation
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Sphingolipid metabolism
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.-.- or 5.5.1.19

Sequence Analysis Tools

See L0GI95 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Psest_0403 lycopene cyclase (Pseudomonas stutzeri RCH2)
MALDADLILVGGGLANGLLALRLRQQRPDLRLLVLEQGDTLGGNHTWSFHEHDLTPAQQR
WLEPMVGKRWPGYAVIFPELQRRLASGYASIFSERFHQYLMPELSDGVRLRTTVASVEPQ
RVRLASGNILQAGAVIDGRGVRRTDQLALGFQKFLGQELRLQQPHGLREPIIMDASVAQH
DGYRFVYVLPFSADSLLIEDTYYADGDTVAPETLRANIERYAQDRGWTIAELLREEQGVL
PIVLSGDLPAFWDEACGVPQTGLAAALFHPTTGYSLPDAVRLADHLIALDRWDATSLFEA
IRDYSLAQWRQRGFFRLLNRMLFMAGPADRRWAVMQRFYRLREPLIQRFYAANLTTRDRL
RIVSGKPPVPLGEALRALAAHDLHRKDYR