Protein Info for Psest_0402 in Pseudomonas stutzeri RCH2

Annotation: glycosyltransferase, MGT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 428 PF00201: UDPGT" amino acids 12 to 394 (383 residues), 63 bits, see alignment E=3.8e-21 TIGR01426: glycosyltransferase, MGT family" amino acids 20 to 415 (396 residues), 132 bits, see alignment E=1.4e-42 PF04101: Glyco_tran_28_C" amino acids 285 to 392 (108 residues), 30.5 bits, see alignment E=5.6e-11 PF06722: EryCIII-like_C" amino acids 305 to 398 (94 residues), 39.9 bits, see alignment E=6.3e-14

Best Hits

KEGG orthology group: K14596, zeaxanthin glucosyltransferase [EC: 2.4.1.-] (inferred from 83% identity to psa:PST_3875)

Predicted SEED Role

"Zeaxanthin glucosyl transferase" in subsystem Carotenoids

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GE67 at UniProt or InterPro

Protein Sequence (428 amino acids)

>Psest_0402 glycosyltransferase, MGT family (Pseudomonas stutzeri RCH2)
MTHFAAIAPPYLSHLRAFEAIAWQLVQRGHRVTFVQQADVAALLELSDAGFTVIGADSHP
PGSLAAVVRRAAQPGPFGIRRVIADMAASTELFCREAPRVLRSLQVDAVLADQMEPAGAL
VAEHLGLPFVSIACALPFNREPLLPLPVMPWRYRATDWGEQLNLHSSRVYDRLMRPHAEV
IERYCQAFGLAPRSTLSDCLSPLLQISQTVADFDFPRRQLPPNFQAVGPLRRPLHGEAEL
NLPIDPARPFVFASLGTLQGHRYGLLRNIARACKPLGVQLLIAHCGGLNAAQAARLRDEG
AHWVTDFAPQRAALARASAVITHAGLNTVLDALEADVPMLALPIAFDQPGVAARIEHAGV
GLRLQPLLASPARISHALQRLLNEGEFRQRAAQLGAEVREAGGAVRAAELIEAALGTDGQ
RAEVASGA