Protein Info for Psest_4078 in Pseudomonas stutzeri RCH2

Annotation: L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00710: Asparaginase" amino acids 7 to 189 (183 residues), 158.2 bits, see alignment E=1.8e-50 PF17763: Asparaginase_C" amino acids 201 to 317 (117 residues), 89.9 bits, see alignment E=1.1e-29

Best Hits

KEGG orthology group: K01424, L-asparaginase [EC: 3.5.1.1] (inferred from 86% identity to psa:PST_0193)

Predicted SEED Role

"L-asparaginase I, cytoplasmic (EC 3.5.1.1)" (EC 3.5.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GP84 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Psest_4078 L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D (Pseudomonas stutzeri RCH2)
MNQPIERLLVLYTGGTIGMQQSAAGLMPASGFEARLRAQQALETGPLPSWTFRELQPLLD
SANMQPSHWLQMATAVREAVAQSDCDAVLLLHGTDTLAYSAAALSFLLLDLEIPVLLTGA
MLPAGSPGSDAWPNLFGAMRALQAGRVEGVRLFFNGVLLHGARVSKLRSDAFDAFAEAPR
KRSATVVGERPPMLLPQQPAQVVVLPLYPGVGAAQVQALVASGAQALLLECYGSGTGPAG
DAPFIEALRQAHRQGVVLAAISQCPGGHVDFGVYATGSGLRDAGLVSGGGMTREAALGKL
FALLTAGLNQAQVEHWFCRDLCGEMAN