Protein Info for Psest_4077 in Pseudomonas stutzeri RCH2

Annotation: amino acid carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 13 to 34 (22 residues), see Phobius details amino acids 60 to 83 (24 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 374 to 392 (19 residues), see Phobius details amino acids 398 to 423 (26 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 10 to 431 (422 residues), 488.5 bits, see alignment E=8.3e-151 PF01235: Na_Ala_symp" amino acids 50 to 443 (394 residues), 523.3 bits, see alignment E=2.4e-161

Best Hits

Swiss-Prot: 48% identical to ALST_BACSU: Amino-acid carrier protein AlsT (alsT) from Bacillus subtilis (strain 168)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 96% identity to psa:PST_0194)

Predicted SEED Role

"Amino-acid carrier protein AlsT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRY3 at UniProt or InterPro

Protein Sequence (473 amino acids)

>Psest_4077 amino acid carrier protein (Pseudomonas stutzeri RCH2)
MLDLLNDLIWSKLLIVMLIGLGLLFTIRSGFVQFRYFGNMFTIFGHAFERQPGQLSSFQA
LMLSVAGRVGAGNIAGVSVAIMLGGPGAIFWMWVVALVGMATSYFECSLAQLYKRREPDG
TYRGGPAFYIQHGLGQRWLGIVVSILLLMTFGFGFNAVQSFTVASSLHDTFGVPTVASGI
ALTLVIAGIIFGGIRRIAKWADVLVPVMAFSYLAMALFVIGSNFSAIPETFGLIFRSAFG
LEQAFAGGIGAAILMGVKRGLFSNEAGLGSAPNVAAVAEVKHPVAQGIVQSLSVFIDTII
LCSCTALIILLSGVYEPGMDQAGVVLTQTAVAAVVGEWGRVFVSVALLLFVFTTLIYNYY
LGENALGFFTEKRMPVVIYRILVVILVLWGSVQDLGTVFAFADVTMGLLAIANLIAVALL
FKVGLRLMRDYDRQIRAGIEQPVLDPKDFADLDLDPAVWKANMPAAPDATERR