Protein Info for PGA1_c00040 in Phaeobacter inhibens DSM 17395

Annotation: putative LysE type translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 41 to 66 (26 residues), see Phobius details amino acids 76 to 94 (19 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details PF01810: LysE" amino acids 17 to 202 (186 residues), 95.5 bits, see alignment E=1.5e-31

Best Hits

KEGG orthology group: None (inferred from 65% identity to rde:RD1_0211)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EI33 at UniProt or InterPro

Protein Sequence (206 amino acids)

>PGA1_c00040 putative LysE type translocator (Phaeobacter inhibens DSM 17395)
MSVSVWDLTLYAGGLFVLFLTPGPVWLAVMARAMSGGFPAAWPLALGVACGDILWPLVAV
AGVSWIVSEVTGLMEVLRWVASAMFLFMGGMLLRHADARIEANSALTRPGLWAGFIAGIA
VILGNPKAILFYMGVLPGFFDLTAVTHLDILAIVVLSFLVPLAGNLCMAGLVHRVRWHIT
SPATLRRINIVSGCLLIGVGCLIPFV