Protein Info for Psest_4057 in Pseudomonas stutzeri RCH2

Annotation: Peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 PF00578: AhpC-TSA" amino acids 6 to 134 (129 residues), 108.7 bits, see alignment E=3e-35 PF08534: Redoxin" amino acids 6 to 148 (143 residues), 53 bits, see alignment E=5.3e-18 PF10417: 1-cysPrx_C" amino acids 156 to 191 (36 residues), 40.8 bits, see alignment 2.5e-14

Best Hits

Swiss-Prot: 61% identical to PRDXL_DICDI: 1-Cys peroxiredoxin (DDB_G0282517) from Dictyostelium discoideum

KEGG orthology group: None (inferred from 100% identity to psa:PST_0214)

MetaCyc: 54% identical to peroxiredoxin-6 monomer (Homo sapiens)
RXN-20693 [EC: 1.11.1.27]

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRW5 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Psest_4057 Peroxiredoxin (Pseudomonas stutzeri RCH2)
MSIRLGDIAPDFEQDSSEGRIRFHEWLGDSWGVLFSHPADFTPVCTTELGFTAKLKDEFA
KRNVKAIALSVDPVDSHIKWIDDINETQNTRVNFPILADADRKVSELYDLIHPNANDTLT
VRSLFVIDPNKKVRLTITYPASTGRNFHEILRVIDSLQLTDNHKVATPANWQDGDEVVIV
PSLKDEEEIKQRFPKGYRAVKPYLRLTPQPNR