Protein Info for Psest_4054 in Pseudomonas stutzeri RCH2

Annotation: alkanesulfonate monooxygenase, FMNH(2)-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR03565: alkanesulfonate monooxygenase, FMNH(2)-dependent" amino acids 4 to 349 (346 residues), 624.4 bits, see alignment E=2.4e-192 PF00296: Bac_luciferase" amino acids 5 to 325 (321 residues), 247.9 bits, see alignment E=8.6e-78

Best Hits

Swiss-Prot: 92% identical to SSUD_PSEMY: Alkanesulfonate monooxygenase (ssuD) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K04091, alkanesulfonate monooxygenase [EC: 1.14.14.5] (inferred from 92% identity to pmy:Pmen_4322)

MetaCyc: 89% identical to alkanesulfonate monooxygenase subunit (Pseudomonas putida DS1)
RXN-18086 [EC: 1.14.14.34]

Predicted SEED Role

"Alkanesulfonate monooxygenase (EC 1.14.14.5)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.14.14.5)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.34 or 1.14.14.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GTA9 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Psest_4054 alkanesulfonate monooxygenase, FMNH(2)-dependent (Pseudomonas stutzeri RCH2)
MSLNIFWFLPTHGDGKYLGTSEGARAVDHSYLGQIAQAADRLGYGGVLIPTGRSCEDSWL
VAASLIPLTQRLKFLVALRPGIISPTVAARQAATLDRLSGGRALFNLVTGGDPDELAGDG
LHLSHAERYEASVEFTRIWRRVLEGGTVDYDGKHLQVKGAKLLYPPIQQPRPALYFGGSS
DAAQDLAAEQVELYLTWGEPLDAVAEKIAQVREKAAQYGRQVRFGIRLHVIVRETDDQAW
AAADRLISHLDDDTIARAQASLARFDSVGQQRMSALHGGRKDNLEVAPNLWAGVGLVRGG
AGTALVGDGPTVAARVKEYADLGIDTFIFSGYPHLEESYRVAELLFPHLDIAQPERPASR
GYVSPFGEMISSDILPKAAAAS