Protein Info for Psest_4051 in Pseudomonas stutzeri RCH2

Annotation: molybdenum-pterin binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 71 TIGR00638: molybdenum-pterin binding domain" amino acids 7 to 69 (63 residues), 63.3 bits, see alignment E=8.5e-22 PF03459: TOBE" amino acids 8 to 67 (60 residues), 61.3 bits, see alignment E=4.1e-21

Best Hits

Swiss-Prot: 34% identical to MOP_HAEIN: Probable molybdenum-pterin-binding protein (HI_1370) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 90% identity to pag:PLES_16191)

Predicted SEED Role

"Organosulfonate utilization protein SsuF" in subsystem Alkanesulfonate assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRB1 at UniProt or InterPro

Protein Sequence (71 amino acids)

>Psest_4051 molybdenum-pterin binding domain (Pseudomonas stutzeri RCH2)
MTIKAINVRNQFKGTIKEIVQGDVLSEIDVQTAAGIVTSVITTRSVRELELQVGSEVIAF
VKSTEVSIAKL