Protein Info for PGA1_c04080 in Phaeobacter inhibens DSM 17395

Annotation: phenylacetic acid degradation protein PaaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 TIGR02156: phenylacetate-CoA oxygenase, PaaG subunit" amino acids 21 to 308 (288 residues), 522.3 bits, see alignment E=1.4e-161 PF05138: PaaA_PaaC" amino acids 31 to 305 (275 residues), 322.6 bits, see alignment E=8.7e-101

Best Hits

Swiss-Prot: 69% identical to PAAA_ECOLI: 1,2-phenylacetyl-CoA epoxidase, subunit A (paaA) from Escherichia coli (strain K12)

KEGG orthology group: K02609, phenylacetic acid degradation protein (inferred from 86% identity to dsh:Dshi_3818)

MetaCyc: 68% identical to ring 1,2-phenylacetyl-CoA epoxidase PaaA subunit (Pseudomonas sp. Y2)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaG subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETU7 at UniProt or InterPro

Protein Sequence (325 amino acids)

>PGA1_c04080 phenylacetic acid degradation protein PaaA (Phaeobacter inhibens DSM 17395)
MYAQMVKSEATQDDPEQLAAFQARIDAGEKIEPKDWMPEGYRKTLIRQIGQHAHSEIVGQ
LPEGNWITRAPTLERKAILLAKVQDEAGHGLYLYCAAETLGVSRDEMTEMLLDGRMKYSS
IFNYPTLNWADIGAVGWLVDGAAIMNQVPLQRTSFGPYSRAMIRVCKEESFHQRQGYDAI
RKMAEGTPAQKKMAQDALNRLWYPSLMMFGPSDKDSVHSAQSMAWKIKMNTNDELRQKFV
DQTVPQAEYLGLTVPDPDLKWNEERGHYDYTDPDWNEFFDVIKGNGPCNVDRLAARNKAW
DDGEWVRDGLLAHAKKKAAQKHAAE