Protein Info for Psest_4039 in Pseudomonas stutzeri RCH2

Annotation: putative toxin-antitoxin system antitoxin component, TIGR02293 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 TIGR02293: putative toxin-antitoxin system antitoxin component, TIGR02293 family" amino acids 28 to 152 (125 residues), 64.6 bits, see alignment E=3.6e-22 PF09722: Xre_MbcA_ParS_C" amino acids 102 to 151 (50 residues), 48.5 bits, see alignment E=3.6e-17

Best Hits

KEGG orthology group: None (inferred from 71% identity to psa:PST_0247)

Predicted SEED Role

"FIG00953091: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GT97 at UniProt or InterPro

Protein Sequence (154 amino acids)

>Psest_4039 putative toxin-antitoxin system antitoxin component, TIGR02293 family (Pseudomonas stutzeri RCH2)
MLVGNQADDYRRRRARLLGLPENATDADMHTHIMKGIPVAQLAKLLRHGDIDAHACEQIT
PGPAPKEHLADMMTIPGVSPGDRLSVDESDRLFRVVHTLVVAELLFGSHEKARRWLSKPK
DRLHGSSPLQMLTSTAGARLVEELMTQLAEGFVL