Protein Info for HP15_3905 in Marinobacter adhaerens HP15
Annotation: lipoprotein, YaeC family
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 47% identical to METQ_SALTI: D-methionine-binding lipoprotein MetQ (metQ) from Salmonella typhi
KEGG orthology group: K02073, D-methionine transport system substrate-binding protein (inferred from 95% identity to maq:Maqu_0253)Predicted SEED Role
"Methionine ABC transporter substrate-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation or Staphylococcal pathogenicity islands SaPI
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PJV9 at UniProt or InterPro
Protein Sequence (260 amino acids)
>HP15_3905 lipoprotein, YaeC family (Marinobacter adhaerens HP15) MNLKKTLAALAAAATFSGAVAAEELSVAATPVPHAEILEFVKPQLAEQGVELDVKVFTDY IQPNIQVDQKRMDANFFQHQPYLDEFNEGRGTNLVTVTGVHVEPFGAYSSKIESLDELKE GAVVAIPNDPTNGGRALLLLQKAGVITLKDESKITATPRDIADNPKDLDFKELEAATLPR ILNQVDLALINTNYALEAGLNPSEDALVIEGSESPYVNILVARPDNKDSEAMQKLAAALK SDAVRDFIMEKYEGAVVPAF