Protein Info for Psest_4022 in Pseudomonas stutzeri RCH2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 272 to 299 (28 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GT12 at UniProt or InterPro

Protein Sequence (495 amino acids)

>Psest_4022 hypothetical protein (Pseudomonas stutzeri RCH2)
MSAVRSFLGAVWSYGVSLPLYVMWSVALSSVRAALDFFYPRGYRPCNELADAFVEECANR
PAGQSVRLPWVDSSATHSLVMNNTGRLLSYVAIASGWFGVTVKNSGTKYRPKRSYRYYYR
RSLTGNWLAEIWSVPKSGFIAAALAIPFVDMARDVMKGRTYANGEFVALPGHEGLMLLMA
GLLLVACFLPRAILGRRTHFVAIAPINGGAFGGYGCAQVINWAAAMAGLSYLWLAMGAEW
NVGAVVSFITSGFSALVGELMGSMVDPGPQVLLMIPVVVAVGILFGMAWTVIPAAAFWYV
SLRFIAARKAKAQLEALPFNSTQTAMYLGSDFEKVAELRAPQVFLGFVVYVGVLLGIVLY
PIATGIAGQAWAKQGEIEPARWDDRASTYFNQNVPTMNIRPGQEYHLQVMEGDSKNGRRV
CEVRAFMSGREIAFRETRGNGPFHDGFNACDYRGVHIRYSKADGYKVAINSMTMLGVDVL
AMAKSLGDTFFTIYL