Protein Info for Psest_0396 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 PF02696: SelO" amino acids 5 to 455 (451 residues), 487.7 bits, see alignment E=1.8e-150

Best Hits

Swiss-Prot: 92% identical to SELO_PSEU5: Protein adenylyltransferase SelO (selO) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: None (inferred from 92% identity to psa:PST_3881)

MetaCyc: 52% identical to protein adenylyltransferase SelO (Escherichia coli K-12 substr. MG1655)
RXN0-7371 [EC: 2.7.7.108]

Predicted SEED Role

"Selenoprotein O and cysteine-containing homologs"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.108

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGX9 at UniProt or InterPro

Protein Sequence (486 amino acids)

>Psest_0396 Uncharacterized conserved protein (Pseudomonas stutzeri RCH2)
MKSLTQLTFDNRFARLGDTFSTEVSPQPLSDPRLVVASEAAMALLDLAPTEAEQPLFTKL
FSGHKIWSTAEPRAMVYSGHQFGSYNPQLGDGRGLLLGEVVNEAGEYWDLHLKGAGKTPY
SRMGDGRAVLRSSIREFLASEHLHALGIPSSRALCVTSSDSLVYRERPERGAMLLRLAPS
HVRFGHFEFFYYTRQHGELKQLLEHVIAAHFAELLEHPEPFHAFFRTVLERTAALIARWQ
AYGFCHGVMNTDNMSILGITFDFGPYAFLDDFDARFICNHSDDTGRYSFENQVPIAHWNL
AALAQALTPFVEVKVLRETMELFLPLYEAEWLDLMRRRLGFAQAEATDDALVRRLLQLMQ
ASAVDYTNFFRELSESPAEQAVRRLREDFVDLQGFDAWAADYCTRTALEGGDPAERQTRM
QAVNPKYILRNYLAQQAIEAAEKGDYAPVRELHTVLARPFEEQPGMQRYAERPPEWGKHL
EISCSS