Protein Info for HP15_3886 in Marinobacter adhaerens HP15

Annotation: energy transducer TonB, C-terminal region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13103: TonB_2" amino acids 154 to 229 (76 residues), 29 bits, see alignment E=9.3e-11 TIGR01352: TonB family C-terminal domain" amino acids 169 to 245 (77 residues), 51.1 bits, see alignment E=6.7e-18 PF03544: TonB_C" amino acids 169 to 245 (77 residues), 51.2 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: K03832, periplasmic protein TonB (inferred from 65% identity to maq:Maqu_0183)

Predicted SEED Role

"Ferric siderophore transport system, periplasmic binding protein TonB" in subsystem Campylobacter Iron Metabolism or Hemin transport system or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJU0 at UniProt or InterPro

Protein Sequence (246 amino acids)

>HP15_3886 energy transducer TonB, C-terminal region (Marinobacter adhaerens HP15)
MMPQQPRSRWGLLLLAFVITFVALVFATPEKTVELNTLGESAVNTAPAIRIKLAGEPAPT
LEPVTAPEPKPQPKPKPKPKPEPEPEPEPDPEPEPEPEPEPEPEPVTQPTPEPEVTEQVT
EAETPVGDPVETETLEQSQATVPLQNAGVRSEVDNYLSRLSRHLAGYYEYPRRARRLGQE
GTPVIVFEFRRDGSLVAHSLRTSSGYQLLDESALAMLEQAEPLPAVPDEISGKKFRYALP
VRFRLR