Protein Info for PGA1_65p00440 in Phaeobacter inhibens DSM 17395

Annotation: UDP-glucuronate 5'-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01370: Epimerase" amino acids 4 to 235 (232 residues), 185 bits, see alignment E=4.9e-58 PF04321: RmlD_sub_bind" amino acids 4 to 211 (208 residues), 46.3 bits, see alignment E=9.6e-16 PF02719: Polysacc_synt_2" amino acids 5 to 222 (218 residues), 39.5 bits, see alignment E=1.2e-13 PF01073: 3Beta_HSD" amino acids 5 to 226 (222 residues), 41.5 bits, see alignment E=2.6e-14 PF16363: GDP_Man_Dehyd" amino acids 5 to 322 (318 residues), 176.4 bits, see alignment E=3.3e-55 PF07993: NAD_binding_4" amino acids 76 to 189 (114 residues), 32.3 bits, see alignment E=1.7e-11

Best Hits

KEGG orthology group: K01789, UDP-glucuronate 5'-epimerase [EC: 5.1.3.12] (inferred from 85% identity to sit:TM1040_3776)

Predicted SEED Role

"UDP-glucuronate 5'-epimerase (EC 5.1.3.12)" (EC 5.1.3.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX77 at UniProt or InterPro

Protein Sequence (336 amino acids)

>PGA1_65p00440 UDP-glucuronate 5'-epimerase (Phaeobacter inhibens DSM 17395)
MKTALITGSAGFIGYHLADRLLAAGWRVIGLDCLSPYYDVRLKECRHARLAEYAGFTPII
GKLEDPDRLMGLFATHKPDAVIHLAAQAGVRHSIDAPRDYLEANLIGTFELLEAARAHPP
AHMLIASTSSAYGANTQMPFDERQQADHQMSFYAATKKAGETMAHSYAHLYGLPTTMFRF
FTVYGPWGRPDMALFKFTQAMQAGQPIDVYNHGRMSRDFTYIDDLVAGITGLIDAVPGDQ
PVSEQDNLSPVAPFRVVNIGASRPTPLMEYIAALETALGITAQKNLMEMQPGDVPATWAD
TSLLNQLTGYEPQVPVEEGVARFVTWYRAYYGDAQG