Protein Info for Psest_0395 in Pseudomonas stutzeri RCH2

Annotation: His Kinase A (phosphoacceptor) domain./Response regulator receiver domain./Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF00072: Response_reg" amino acids 11 to 122 (112 residues), 80 bits, see alignment E=2.3e-26 PF00512: HisKA" amino acids 170 to 242 (73 residues), 46.4 bits, see alignment E=4.9e-16 PF02518: HATPase_c" amino acids 288 to 395 (108 residues), 95.6 bits, see alignment E=3.8e-31

Best Hits

KEGG orthology group: None (inferred from 93% identity to psa:PST_3882)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG96 at UniProt or InterPro

Protein Sequence (396 amino acids)

>Psest_0395 His Kinase A (phosphoacceptor) domain./Response regulator receiver domain./Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase. (Pseudomonas stutzeri RCH2)
MPDRADEVNLLIVDDLPENLLALDALLQAPGVRVHQAESAEQALELLLRYEFALAILDVQ
MPGMDGFQLAELMRGTERTKQIPIVFVSAAGRELNYAFKGYESGAVDFMHKPLDAHAVRS
KVSVFVDLYRSRKRLARQLEALERSRREQEVLLDELRSTKAELEDAVRMRDDFMSIVSHE
LKTPLNTLILEVQLRKLQLGRNNFAAFSEERLRNMVDKDERQVQSLIRLIDDMLDVSRIR
TGKLSIRPSRTDLAELVGNVVESFAAQMEACGCELRLERAESIIGVWDAFRIEQVLANLL
TNAMRYGAGKPVQVSVTSCAEGACIEVRDHGIGISPQSLERIFCQFERAEGSEGSAGLGL
GLFIADQIVRAHNGRIQVQSVEGQGSQFRVLLPLGE