Protein Info for Psest_4002 in Pseudomonas stutzeri RCH2

Annotation: Phosphate/sulphate permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 305 to 325 (21 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 397 to 420 (24 residues), see Phobius details PF01384: PHO4" amino acids 26 to 409 (384 residues), 403.8 bits, see alignment E=3.3e-125

Best Hits

KEGG orthology group: K03306, inorganic phosphate transporter, PiT family (inferred from 85% identity to psa:PST_0273)

Predicted SEED Role

"Probable low-affinity inorganic phosphate transporter" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR66 at UniProt or InterPro

Protein Sequence (421 amino acids)

>Psest_4002 Phosphate/sulphate permeases (Pseudomonas stutzeri RCH2)
MSFIADYGFVLLVLACMFGFFMAWGVGANDVANAMGTSVGSRALTIKQAIVVAMVFEFCG
AYLAGGQVTETIKSGIVDASAIPPELMVLGMMSALLAAGTWLLIASIKGWPVSTTHSIVG
AVIGFAAVGISVDAVHWSGVGPIVASWVVSPMLSGTIAFGLFISVQRLIIDTDEPFQNAK
RFVPLYMFLTGFMVALMTLSKGLKHIGLDLSSGQSFMLAVGVGALVMLIGVALLTRIKVD
VEADKAFHFSSVEKVFAVLMIFTACSMAFAHGSNDVANAVGPLAAVVGVLQSEGAAVIGA
KAAVPGWVLLLGAVGIVIGLATYGYKVIATIGKQITELTPSRGFAAELATATTVVGASAI
GLPVSTTHTLVGAVLGVGIARGIGALNLGVVGKIFMSWLVTLPVGAGLAIVFFLILRAIF
T