Protein Info for HP15_3869 in Marinobacter adhaerens HP15
Annotation: short-chain dehydrogenase/reductase SDR
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to SADH_MYCTU: Putative oxidoreductase SadH (sadH) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
KEGG orthology group: None (inferred from 92% identity to maq:Maqu_0158)Predicted SEED Role
"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PJ35 at UniProt or InterPro
Protein Sequence (273 amino acids)
>HP15_3869 short-chain dehydrogenase/reductase SDR (Marinobacter adhaerens HP15) MTMKKLKNKVAVVTGAGSGIGRALAKSLADRGCRLALSDVNESGLAETAAALSGADVKTY RLDVSDRDAIFAHAEEVAKDFGQVNLVINNAGVALSATVREMTDEDFKWVMDIDFWGVAH GTRAFLPHLIASGDGHVVNVSSVFGLIGVPKQSAYNAAKFAVRGFTEALRQEMKLENQPV AVSCVHPGGIRTNIANAARMGKSENAVAQRKGFDKLAMTTPEKAAETIVKGILKNESRIL VGPDAWGIDAINRLLGSAYQPLVERFSRKNLYI