Protein Info for HP15_3869 in Marinobacter adhaerens HP15

Annotation: short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00106: adh_short" amino acids 9 to 199 (191 residues), 178.8 bits, see alignment E=1.8e-56 PF08659: KR" amino acids 12 to 172 (161 residues), 68 bits, see alignment E=2.2e-22 PF13561: adh_short_C2" amino acids 15 to 229 (215 residues), 132.6 bits, see alignment E=3.6e-42

Best Hits

Swiss-Prot: 55% identical to SADH_MYCTU: Putative oxidoreductase SadH (sadH) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 92% identity to maq:Maqu_0158)

Predicted SEED Role

"Oxidoreductase, short chain dehydrogenase/reductase family" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJ35 at UniProt or InterPro

Protein Sequence (273 amino acids)

>HP15_3869 short-chain dehydrogenase/reductase SDR (Marinobacter adhaerens HP15)
MTMKKLKNKVAVVTGAGSGIGRALAKSLADRGCRLALSDVNESGLAETAAALSGADVKTY
RLDVSDRDAIFAHAEEVAKDFGQVNLVINNAGVALSATVREMTDEDFKWVMDIDFWGVAH
GTRAFLPHLIASGDGHVVNVSSVFGLIGVPKQSAYNAAKFAVRGFTEALRQEMKLENQPV
AVSCVHPGGIRTNIANAARMGKSENAVAQRKGFDKLAMTTPEKAAETIVKGILKNESRIL
VGPDAWGIDAINRLLGSAYQPLVERFSRKNLYI