Protein Info for HP15_3858 in Marinobacter adhaerens HP15

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details PF11911: DUF3429" amino acids 5 to 142 (138 residues), 76.9 bits, see alignment E=9.4e-26

Best Hits

KEGG orthology group: None (inferred from 72% identity to maq:Maqu_0151)

Predicted SEED Role

"FIG00785424: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJ24 at UniProt or InterPro

Protein Sequence (152 amino acids)

>HP15_3858 aspartate kinase (Marinobacter adhaerens HP15)
MIAVARLAILVGIAGLIPFIGLLAGLFFMPQYSVALLGYFYLYSAGILAFMAGVYWPIAM
QLDNCCYPLSPLMTMLLSQVFFVAAGVGLLLPVSGQIVLYTSAYLALYLVDARWMKVYWP
AWYLRLRLVLTSVVLVCQLTAAAWFLLLHTAH