Protein Info for Psest_3984 in Pseudomonas stutzeri RCH2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 673 PF08495: FIST" amino acids 43 to 250 (208 residues), 96.3 bits, see alignment E=3.4e-31 PF10442: FIST_C" amino acids 265 to 389 (125 residues), 53.5 bits, see alignment E=4.3e-18 PF00015: MCPsignal" amino acids 533 to 636 (104 residues), 105.3 bits, see alignment E=4.9e-34

Best Hits

KEGG orthology group: None (inferred from 92% identity to psa:PST_0297)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNX0 at UniProt or InterPro

Protein Sequence (673 amino acids)

>Psest_3984 Methyl-accepting chemotaxis protein (Pseudomonas stutzeri RCH2)
MSLFSRLKAGTGAGEGVLGLHVSARQLAAELAGLRFEPTYIAGFVSPHVDIDSVAQQLRQ
RFPRATISLCSTAGELSSESRQLYCATSGQWDGVVLQLFDASVIAAAEIILVPLECEDIR
GQGQRLSMGERIARLTASIKRVQVSMKIDYRDTLANIFFDGLSASESFFMEALYESGRFP
CLFVGGSAGGKLDFQKTQLHDGKRSYQNHALIVFLKCARDVRFGVFKSQNFEPTALSLNV
LSASLEDRYISQVVDARGNIRTMVQALCEALKCAPQELEQRLADYSFAIRVGQEVFVRSI
SQIDFANERVHLFCDVAPGEELIMVKRTPLAETTRRDYQQFMRNKPGKPLVGILNDCILR
RLNNEQALGGMDPVFDDVPVAGYSTFGEILGLNLNQTLTAVFFFRTNGKDDFHDEYTDNF
IAYHGEFKAFFLRRQIKKLTGLSQVVVKQIEQFKRQDYSSAVDINGLDEHIRPVFRGLAD
LGQVLSQADHERQSMSEQLSQCANELHGSMDDLTLNINQQGTVIEQAGSSVKQMVHQADE
VVSSARDLAQSSQRIQSVVQTIQQIAGQTNLLALNAAIEAARAGEMGRGFAVVADEVRKL
AEITGKNAEEIGTDIDRLASEIRAVAQHIETQSAGVGSLTGLLDALENSSNLTAGTSRQT
KGVADRLIGLTAR