Protein Info for HP15_3854 in Marinobacter adhaerens HP15
Annotation: L-2,4-diaminobutyric acid acetyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to ECTA_META2: L-2,4-diaminobutyric acid acetyltransferase (ectA) from Methylomicrobium alcaliphilum (strain DSM 19304 / NCIMB 14124 / VKM B-2133 / 20Z)
KEGG orthology group: K06718, L-2,4-diaminobutyric acid acetyltransferase [EC: 2.3.1.178] (inferred from 95% identity to maq:Maqu_0147)MetaCyc: 46% identical to diaminobutanoate acetyltransferase monomer (Halomonas elongata DSM 2581)
Diaminobutyrate acetyltransferase. [EC: 2.3.1.178]
Predicted SEED Role
"L-2,4-diaminobutyric acid acetyltransferase (EC 2.3.1.-)" in subsystem Ectoine biosynthesis and regulation (EC 2.3.1.-)
MetaCyc Pathways
- ectoine biosynthesis (5/5 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Anthocyanin biosynthesis
- Benzoate degradation via CoA ligation
- Biosynthesis of terpenoids and steroids
- Biosynthesis of type II polyketide backbone
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Carotenoid biosynthesis - General
- Diterpenoid biosynthesis
- Ether lipid metabolism
- Ethylbenzene degradation
- Fatty acid biosynthesis
- Glycerophospholipid metabolism
- Glycine, serine and threonine metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Histidine metabolism
- Limonene and pinene degradation
- Lipopolysaccharide biosynthesis
- Lysine degradation
- Phenylalanine metabolism
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.3.1.-
Use Curated BLAST to search for 2.3.1.- or 2.3.1.178
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PJ20 at UniProt or InterPro
Protein Sequence (171 amino acids)
>HP15_3854 L-2,4-diaminobutyric acid acetyltransferase (Marinobacter adhaerens HP15) MTSEGSNTTAITLRTPVKDDGFRLHQLVAECPPLDPNSIYCNLLQCSHFAETGVAAEKDG DLVGFISGYIPPQQPETVFVWQVAVHEKGRGQGLAKRMLKEIVGRDACKNVTHMETTITE DNEASWALFRSFARDMGAELTYHEHFEKETHFGGKHDSEFLLRIGPFTKPA