Protein Info for Psest_3973 in Pseudomonas stutzeri RCH2

Annotation: Anti-sigma regulatory factor (Ser/Thr protein kinase)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF13581: HATPase_c_2" amino acids 16 to 131 (116 residues), 33.6 bits, see alignment E=3.7e-12 PF02518: HATPase_c" amino acids 37 to 131 (95 residues), 45.1 bits, see alignment E=1.3e-15

Best Hits

Swiss-Prot: 42% identical to RSBT_BACSU: Serine/threonine-protein kinase RsbT (rsbT) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 84% identity to pfv:Psefu_1633)

Predicted SEED Role

"anti-sigma B factor RsbT" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRM5 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Psest_3973 Anti-sigma regulatory factor (Ser/Thr protein kinase) (Pseudomonas stutzeri RCH2)
MIVRSSGSQPVRLEQDVVLARQTVRKLTQECAMRLIDQTKLVTAVSELARNTVVYGGGGD
MDWQLIEDGTRVGVRLTFRDEGPGIADIKLAMTDGWTSGSGLGLGLTGAKRLVDEFELDS
TVGVGTRITITRWT