Protein Info for Psest_3972 in Pseudomonas stutzeri RCH2

Annotation: Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF01740: STAS" amino acids 11 to 96 (86 residues), 32.7 bits, see alignment E=2.7e-12

Best Hits

Swiss-Prot: 46% identical to RSBS_BACSU: RsbT antagonist protein RsbS (rsbS) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 87% identity to pfo:Pfl01_3134)

Predicted SEED Role

"RsbS, negative regulator of sigma-B" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR21 at UniProt or InterPro

Protein Sequence (120 amino acids)

>Psest_3972 Anti-anti-sigma regulatory factor (antagonist of anti-sigma factor) (Pseudomonas stutzeri RCH2)
MDRIPILRMGEFLLVTIQVDMHDQLALTLQDDLAERISATSAKAVLIDISALDMVDSFIG
RMIGTISGLSRIMDAETVVVGMQPAVAITLVELGLELPGVSTALNVERGMQLLRARVAAQ