Protein Info for Psest_3966 in Pseudomonas stutzeri RCH2

Annotation: Predicted thioesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF20791: Acyl-ACP_TE_C
  • amino acids 13 to 40 (28 residues), 21.2 bits, 4.2e-08
• PF13279: 4HBT_2
  • amino acids 21 to 139 (119 residues), 61.1 bits, E=2.2e-20
• PF03061: 4HBT
  • amino acids 28 to 109 (82 residues), 50.7 bits, E=2.8e-17

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 95% identity to psa:PST_0313)

Predicted SEED Role

"putative 4-hydroxybenzoyl-CoA thioesterase" in subsystem Gentisare degradation

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Ubiquinone and menaquinone biosynthesis
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.-

Sequence Analysis Tools

See L0GST6 at UniProt or InterPro

Protein Sequence (143 amino acids)

>Psest_3966 Predicted thioesterase (Pseudomonas stutzeri RCH2)
MPEQPKHLRRDYKHFQPITTRWHDNDIYGHVNNVVYYGFFDTAVNNYLIQQGGLDIRDGD
IVGFVVSSACDYFASIAYPDLIEVGVRVAKLGNSSVQYELAIFREGEQEASAAGRFVHVF
VERASNRPTPIPGRLRAALEALA