Protein Info for Psest_0390 in Pseudomonas stutzeri RCH2

Annotation: Short-chain dehydrogenases of various substrate specificities

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 305 to 325 (21 residues), see Phobius details PF00106: adh_short" amino acids 5 to 191 (187 residues), 142.4 bits, see alignment E=1.9e-45 PF08659: KR" amino acids 5 to 167 (163 residues), 56.6 bits, see alignment E=4.9e-19 PF13561: adh_short_C2" amino acids 10 to 182 (173 residues), 93.5 bits, see alignment E=2.3e-30

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_3887)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GG91 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Psest_0390 Short-chain dehydrogenases of various substrate specificities (Pseudomonas stutzeri RCH2)
MPEPTAVICGATAGVGRATAEAFAKAGYRVALIARGEQGLRDTQEQLEALGATVLAISAD
VADAAALDAAASRIEAELGAIDVWVNAAMATVFGPFAALTAEEIRRVTEVTYLGSVHGTL
AALRHMRSRNRGTIVQVGSALAYRAIPLQSAYCGAKFAIRGFIDSLRCELIHDNSAIRLS
MVQLPAHNTPQFEWARNKIGWRAQPVPPIHTPEVAARAILHAAREAPRELWVGSASLKAI
IGTLFMPGLLDRMLARQAWDGQLIPERAPEGRPDNLFEPVEGLHATEGRFSDQAQPRALA
LSSATVGKLALGAGTLLALGAGWALGRRRR