Protein Info for HP15_3815 in Marinobacter adhaerens HP15

Annotation: organic radical activating enzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR04508: 7-carboxy-7-deazaguanine synthase" amino acids 2 to 218 (217 residues), 329.5 bits, see alignment E=4.7e-103 PF04055: Radical_SAM" amino acids 45 to 128 (84 residues), 44.5 bits, see alignment E=9.9e-16

Best Hits

Swiss-Prot: 58% identical to QUEE_BRADU: 7-carboxy-7-deazaguanine synthase (queE) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 88% identity to maq:Maqu_0107)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIY1 at UniProt or InterPro

Protein Sequence (218 amino acids)

>HP15_3815 organic radical activating enzyme (Marinobacter adhaerens HP15)
MYRVKEAFYTLQGEGAQAGRAAVFCRFSKCNLWTGREKDRATAVCNFCDTDFVGTDGQNG
GRFETPEELARHIRNLWPEAPGKPYVVCTGGEPLLQLDAPLIEALHREGFEVGVETNGTL
PAPEGIDWLCVSPKADAPVVLEACDELKLVYPQPLAMPERFLGIRASHYFLSPMASPSIP
ETAVDEIKQSNTRRATDYCLAHPQWRLTLQMHKIIGID