Protein Info for Psest_3942 in Pseudomonas stutzeri RCH2

Annotation: 2-polyprenylphenol 6-hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 transmembrane" amino acids 31 to 44 (14 residues), see Phobius details amino acids 491 to 510 (20 residues), see Phobius details amino acids 516 to 534 (19 residues), see Phobius details TIGR01982: 2-polyprenylphenol 6-hydroxylase" amino acids 8 to 447 (440 residues), 578.4 bits, see alignment E=3.9e-178 PF03109: ABC1" amino acids 96 to 344 (249 residues), 268.8 bits, see alignment E=1.8e-84

Best Hits

Swiss-Prot: 77% identical to UBIB_PSEPW: Probable protein kinase UbiB (ubiB) from Pseudomonas putida (strain W619)

KEGG orthology group: K03688, ubiquinone biosynthesis protein (inferred from 95% identity to psa:PST_0338)

Predicted SEED Role

"Ubiquinone biosynthesis monooxygenase UbiB" in subsystem Ubiquinone Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQY9 at UniProt or InterPro

Protein Sequence (536 amino acids)

>Psest_3942 2-polyprenylphenol 6-hydroxylase (Pseudomonas stutzeri RCH2)
MKLFAAARRLFRILLVVIRYRLDDIILDLPMPWWLRATSYLLPWRWIPRRRSELSRGARL
RLALEGLGPIFIKFGQILSTRRDLLPPDIAEELAMLQDRVPPFDSAVATALIERQLGASV
GEIFARFDSKPLASASVAQVHAAKLRSGEEVVVKVVRPNLKPIISQDLAWLFMLANSAER
ISIDARRLHLVEVVDDYAKTIYDELDLLREAANASQLKRNFEGSPLLYVPQIYWDYCRPQ
VLVMERIYGVPVTDMAGLARQNTDMRQLAERGVEIFFTQVFRDSFFHADMHPGNIFVSSH
QPWSPQYIAVDFGIVGSLTPEDQDYLARNLMAFFKRDYRKVAQLHIDSGWVPAETKVNEF
EAAIRTVCEPIFEKPLKDISFGQLLVRLFQVARRFNMEVQPQLVLLQKTLLNIEGLGREL
YPDLDLWSTGQPYLERWMRERMSPKQLIKNVHAQIEQLPHLAHMTRELLERMSHPHANNP
PPPWRERHRGWPLRLIGALLLGSGATLAASAENLAAITAWPAWVMLVAGVFIVVRR