Protein Info for PGA1_78p00350 in Phaeobacter inhibens DSM 17395

Annotation: FAD dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 PF01266: DAO" amino acids 42 to 401 (360 residues), 200.9 bits, see alignment E=1.2e-62 PF00890: FAD_binding_2" amino acids 43 to 265 (223 residues), 28.5 bits, see alignment E=2.4e-10 PF13450: NAD_binding_8" amino acids 44 to 82 (39 residues), 23.5 bits, see alignment 1.4e-08

Best Hits

KEGG orthology group: None (inferred from 46% identity to rde:RD1_0165)

Predicted SEED Role

"Oxidoreductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX05 at UniProt or InterPro

Protein Sequence (445 amino acids)

>PGA1_78p00350 FAD dependent oxidoreductase (Phaeobacter inhibens DSM 17395)
MRRIYEPLAYTDRPIRARYWDRFLPDPAPCYAPLQDEVTAEFAVIGGGYTGLSAALTLAE
AGADVVLLDAQRPGWGASGRNGGLVSVGSAKLADDAILRRYGQADAEQFFAAERAAVDLV
ETYVERLALEVDRHSRGYTFVAHRPDRLTELHDYGQEYTRRYGLSYEFIPKEEMAAHGLN
SPEFHGAVNLPVGFALNPMKFVLGLTRAVEAAGVRMFSDTPVQAITPAAGGYLLQGPAGQ
VRARHLLIATNGYSSDDLPQALAGRYLPVQSNIMVTRPLSEAEIADQGWWSEQMVCDSRT
LLHYLRLLPDRRLLLGLRGSVRVSEENIAVTKARARADFDRMFPAWRAVETAHFWSGLIC
MTRNLVPFAGAIPGMKNAWAALGYHGSGVCMAPYAGALIADQALGRHQRPHPDLMQRPLR
RFELGRWRRLSLPLAFGWYHIKDRI