Protein Info for Psest_3940 in Pseudomonas stutzeri RCH2

Annotation: ubiquinone/menaquinone biosynthesis methyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF01209: Ubie_methyltran" amino acids 25 to 255 (231 residues), 332.2 bits, see alignment E=6.9e-103 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 30 to 255 (226 residues), 281 bits, see alignment E=2.7e-88 PF13489: Methyltransf_23" amino acids 52 to 239 (188 residues), 60.6 bits, see alignment E=7.4e-20 PF01135: PCMT" amino acids 61 to 173 (113 residues), 31.6 bits, see alignment E=6.3e-11 PF05175: MTS" amino acids 67 to 174 (108 residues), 23.1 bits, see alignment E=2.2e-08 PF13847: Methyltransf_31" amino acids 69 to 234 (166 residues), 80.3 bits, see alignment E=6.1e-26 PF13649: Methyltransf_25" amino acids 72 to 169 (98 residues), 82.9 bits, see alignment E=9.7e-27 PF08241: Methyltransf_11" amino acids 73 to 173 (101 residues), 76.7 bits, see alignment E=8.4e-25 PF08242: Methyltransf_12" amino acids 73 to 171 (99 residues), 51.3 bits, see alignment E=7.3e-17

Best Hits

Swiss-Prot: 97% identical to UBIE_PSEU5: Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (ubiE) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03183, ubiquinone/menaquinone biosynthesis methyltransferase [EC: 2.1.1.- 2.1.1.163] (inferred from 97% identity to psa:PST_0340)

MetaCyc: 70% identical to bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinol methylase and demethylmenaquinone methyltransferase (Escherichia coli K-12 substr. MG1655)
2-OCTAPRENYL-METHOXY-BENZOQ-METH-RXN [EC: 2.1.1.201]; ADOMET-DMK-METHYLTRANSFER-RXN [EC: 2.1.1.201, 2.1.1.163]

Predicted SEED Role

"Ubiquinone/menaquinone biosynthesis methyltransferase UbiE (EC 2.1.1.-)" in subsystem Menaquinone Biosynthesis via Futalosine or Menaquinone and Phylloquinone Biosynthesis or Ubiquinone Biosynthesis (EC 2.1.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.163 or 2.1.1.201

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSY2 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Psest_3940 ubiquinone/menaquinone biosynthesis methyltransferases (Pseudomonas stutzeri RCH2)
MTDPRKAHDAEPTTHFGYKNVPESQKAQKVAEVFHSVAAKYDLMNDLMSGGVHRLWKRFT
IELSGARHGNRVLDIAGGTGDLTRQFSRIVGPTGEVVLADINASMLKVGRDKLLDKGVAG
NVKFVQADAEKLPFPDNHFDVVTIAFGLRNVTHKEDAIASMLRVLKPGGRLLVLEFSKPT
NQLFSKAYDAYSFSLLPMMGKLITNDAESYRYLAESIRMHPDQETLKSMMETAGFERVSY
HNMTGGIVALHRGIKP