Protein Info for HP15_3810 in Marinobacter adhaerens HP15
Annotation: response regulator receiver protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 85% identity to maq:Maqu_0102)Predicted SEED Role
"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PIX6 at UniProt or InterPro
Protein Sequence (137 amino acids)
>HP15_3810 response regulator receiver protein (Marinobacter adhaerens HP15) MTDLKVLVVEDEPVMRERLVDMLYNAGATKVIECIDAASARTAFKAGEFHIILLDLGLPD GDGHELMLEFKDAREEQHIVLVTADDSIESIQRAISAGANGYVVKPYSQEKIHDVVNNYA MVHGGDMAMMQGLNRRH