Protein Info for PGA1_78p00300 in Phaeobacter inhibens DSM 17395

Annotation: glycine cleavage system protein GcvH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01597: GCV_H
  • amino acids 4 to 119 (116 residues), 140.3 bits, E=1.5e-45
• TIGR00527: glycine cleavage system H protein
  • amino acids 4 to 120 (117 residues), 145.4 bits, E=5e-47

Best Hits

Swiss-Prot: 67% identical to GCSH_DINSH: Glycine cleavage system H protein (gcvH) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 74% identity to sil:SPOA0058)

MetaCyc: 50% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Sequence Analysis Tools

See I7DWZ7 at UniProt or InterPro

Protein Sequence (121 amino acids)

>PGA1_78p00300 glycine cleavage system protein GcvH (Phaeobacter inhibens DSM 17395)
MTTYYSEDHEWITVEGDTATLGITKHAADQLGEVVFVEQQDSGEEFEKGGEIGVIESVKA
ASEIYAPLDGEITAVNEDLADNPSALNEDPEGAAWIYKIKLSDSAQLEDLMDLDGYKALI
G