Protein Info for Psest_0387 in Pseudomonas stutzeri RCH2

Annotation: Membrane-bound serine protease (ClpP class)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 248 to 270 (23 residues), see Phobius details amino acids 277 to 296 (20 residues), see Phobius details amino acids 301 to 318 (18 residues), see Phobius details amino acids 325 to 344 (20 residues), see Phobius details amino acids 351 to 377 (27 residues), see Phobius details PF25145: NfeD1b_N" amino acids 34 to 217 (184 residues), 59.6 bits, see alignment E=5e-20 PF24961: NfeD_membrane" amino acids 257 to 373 (117 residues), 87.5 bits, see alignment E=1.1e-28 PF01957: NfeD" amino acids 390 to 446 (57 residues), 44.5 bits, see alignment 2.2e-15

Best Hits

KEGG orthology group: K07403, membrane-bound serine protease (ClpP class) (inferred from 87% identity to psa:PST_3890)

Predicted SEED Role

"Putative membrane-bound ClpP-class protease associated with aq_911" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GE52 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Psest_0387 Membrane-bound serine protease (ClpP class) (Pseudomonas stutzeri RCH2)
MPRHPLSWLLFLLCALAVQGASAAAPVTLLRVDGAIGPASADYVLRGLEHARDEGAQLVV
LELDTPGGLDVSMRAIIKAILASPIPVATYVTPSGARAASAGTYMLYASHVAAMAPGTNL
GAATPVQIGGGMPGAPPEQPKGEKDEDTQKPADAMSRKQINDAAAYIRGLAQLRERNAEW
AEQAVREAVSLSASEALELEVIDYLARDVADLLRQLDGKTLATIAGDVSLNTADAQLIEH
APDWRVRLLAVITNPSVALILMMIGIYGLILEFSSPGMGGGGVLGCICLILALYALQLLP
VNYAGVALILLGIAFMVAEGFLPSFGMLGIGGVAAFVTGAVILIDTDVPGFGIPLSLIVP
LGIISALLVFALVAMALKARRQRLVSGDSALIGSLVLVDAVPTQNPHSGWVHLHGENWQV
RSTTALQVGQQVRVIARDGLQLEVAPPSATNREELNHGL