Protein Info for HP15_3793 in Marinobacter adhaerens HP15

Annotation: protein containing RNA polymerase sigma factor 54, interaction / helix-turn-helix, Fis-type

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 PF00989: PAS" amino acids 24 to 80 (57 residues), 23.2 bits, see alignment 2e-08 PF08448: PAS_4" amino acids 25 to 116 (92 residues), 24.8 bits, see alignment E=7.7e-09 PF14532: Sigma54_activ_2" amino acids 161 to 332 (172 residues), 75 bits, see alignment E=2.6e-24 PF00158: Sigma54_activat" amino acids 161 to 327 (167 residues), 222.3 bits, see alignment E=1.1e-69 PF07728: AAA_5" amino acids 183 to 302 (120 residues), 22.6 bits, see alignment E=3.2e-08 PF02954: HTH_8" amino acids 428 to 469 (42 residues), 50.9 bits, see alignment 3.7e-17

Best Hits

KEGG orthology group: None (inferred from 87% identity to maq:Maqu_0084)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIV9 at UniProt or InterPro

Protein Sequence (470 amino acids)

>HP15_3793 protein containing RNA polymerase sigma factor 54, interaction / helix-turn-helix, Fis-type (Marinobacter adhaerens HP15)
MTQLFSDNNKSGLTRDLIEALFPMFEEASAGAIAVDCDARITWINSSYSHLLGLGDPSTI
IGKPVRQLIPHTRMPEVVETGKPLLLDIMEHNQQQLVVTRLPYYDDNGKIVGAVAFVLYD
DLQPLTPLVSKYRRLHQDLAAARKALAKKARGTRYSLGDFVGASPAALEVKRRARLAAGR
DMPVLLLGETGTGKEVLAQAIHTVSGRAEKPFVGVNVAAIPDNLLEAEFFGVAPGAYTGA
DRRTREGKFQLANGGTLFLDEVGDMPLPLQAKLLRALQEGEIEPLGSNKVVSVDVRVIAA
TSRNLEVMISEGTFRSDLYYRLNVLEIPIPPLRDRLADLGVLCEALLEEICEGLELRGEI
TDAGVSALGSYDWPGNIRELRNVLERAMTMGEEGGLLDADAIFKVLPRAGTRPVSSLAPQ
PVRPLSQTLAEAEAQAIEEALVASRGNRTRAAKLLGISRSVLYEKLAKLS