Protein Info for Psest_3920 in Pseudomonas stutzeri RCH2

Annotation: Polyketide cyclase / dehydrase and lipid transport.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 48 to 65 (18 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 139 to 155 (17 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 56 to 210 (155 residues), 38.5 bits, see alignment E=1.5e-13 PF10604: Polyketide_cyc2" amino acids 224 to 359 (136 residues), 57.5 bits, see alignment E=1.8e-19

Best Hits

KEGG orthology group: None (inferred from 56% identity to pau:PA14_37130)

Predicted SEED Role

"Sterol desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSW3 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Psest_3920 Polyketide cyclase / dehydrase and lipid transport. (Pseudomonas stutzeri RCH2)
MQFDTTSFRARYRASIKPGYNAWLHGGFVLLFGALCIGFLLSRVAAPSPWEWLTVPLALI
FYNWGEYKIHKNLGHVKHGFSKLFYQRHTGDHHSFFAYGQMNYETPRDWRVIFFPAWLIA
VYATINLTLFWVLSQWNSNVAALFCATLLLGYLAYETMHASEHLPEQHPLLKMPGLRRMR
RLHELHHARELMHNFNFNIVFPLWDWLYGTLYWEAEGAESDQPMTRIQQHVDIQRSPDLL
LAYLATPTRWHEWHHYPVSIKGPSGTLGAGSRFEYSSERASYLLWDVLEYLPGQRWTARA
RGNYGLQMRVTYECSPQGTGSRFTRSMEYRFDHLFGRLANRLFLHRRLQQDSADLLKHLG
IVAEHVIPSAGTASMNGLQAGGTRVR