Protein Info for PGA1_78p00140 in Phaeobacter inhibens DSM 17395

Annotation: Sugar phosphate isomerases/epimerases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF01261: AP_endonuc_2" amino acids 30 to 322 (293 residues), 118.2 bits, see alignment E=2.6e-38

Best Hits

KEGG orthology group: None (inferred from 76% identity to mlo:mll3362)

Predicted SEED Role

"Inosose isomerase (EC 5.3.99.-)" in subsystem Inositol catabolism (EC 5.3.99.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F4Y3 at UniProt or InterPro

Protein Sequence (351 amino acids)

>PGA1_78p00140 Sugar phosphate isomerases/epimerases (Phaeobacter inhibens DSM 17395)
MKTQIKGPALFLAQFAGDEAPFNSLDTITKWAAGLGYRGVQIPTFDSRLFDLERAAESQT
YCDEVKGICADAGVEITELSTHLQGQLVAVNPAYDLALDAFAPEQCRGNPVKRQAWAVDQ
MHKAALASQRLGLSHTVSFTGSLAFPYLYPWPQRPEGLIEETFIELGRRWTPILNHYADC
GQDIGFELHPGEDVFDGATFEMFVEACGGHAAAMINYDPSHFLLQQLDYLAFIDLYHDRI
NAFHVKDAEFNPDGRQGVYSGYQNWTNRAGRFRSLGDGQVDFSAIFSKLTQYGYDSWAVL
EWECCLKSPAQGAAEGAPFIKRHLIEVTDKAFDDFAGGERDNDTIREMLGL