Protein Info for Psest_3914 in Pseudomonas stutzeri RCH2

Annotation: Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF00561: Abhydrolase_1" amino acids 35 to 276 (242 residues), 69.5 bits, see alignment E=3.6e-23 PF12697: Abhydrolase_6" amino acids 36 to 281 (246 residues), 70.7 bits, see alignment E=2.9e-23

Best Hits

KEGG orthology group: None (inferred from 93% identity to psa:PST_0361)

Predicted SEED Role

"Alpha/beta hydrolase fold (EC 3.8.1.5)" (EC 3.8.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSV6 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Psest_3914 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) (Pseudomonas stutzeri RCH2)
MSSTDIALDTWRASAREFDFGGKRIRYWMAGDGEPLLLIHGFPTASWDWHKVWQSLAARY
RLIACDMLGFGYSAKPRGHAYSLIEQADLQQALLAELGIGGAIHVLAHDYGDSVAQELLA
RHCEGRIALASCVFLNGGLFPETHHPVRVQKLLLGPFGFLLGRLFSRRSLGATFGRVFGA
QTQPSDAELDDYWRLIAEGNGPAVMHRLIRYMPERVRQRERWVTAMQRCNVPLRVIDGAA
DPISGAHMVARYRELIPAPDTVLLEGIGHYPQVEAPEQVLEHYFDFRTRLAPGACGH