Protein Info for PGA1_78p00070 in Phaeobacter inhibens DSM 17395

Annotation: 'RNA polymerase sigma-70, ECF subfamily; ECF26 subgroup'

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF04542: Sigma70_r2" amino acids 26 to 87 (62 residues), 54.5 bits, see alignment E=1.6e-18 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 26 to 174 (149 residues), 68.2 bits, see alignment E=3.3e-23 PF22029: PhyR_sigma2" amino acids 26 to 75 (50 residues), 36.1 bits, see alignment E=1.1e-12 PF08281: Sigma70_r4_2" amino acids 121 to 173 (53 residues), 47.3 bits, see alignment E=2.7e-16

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 44% identity to sal:Sala_2957)

Predicted SEED Role

"RNA polymerase sigma-54 factor RpoN" in subsystem Flagellar motility or Flagellum or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ET33 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PGA1_78p00070 'RNA polymerase sigma-70, ECF subfamily; ECF26 subgroup' (Phaeobacter inhibens DSM 17395)
MISASLSDSQAQMSPDQFKSEMIGLLPRLRRFALSLTRSGADADDLLQEACALALQKWQQ
YDPAQPLDRWMFRVLRNLWVSEIRKRRVRQGAGVVPVEEATELAASGVSGADVAETTLTA
RQVQSRIADMDPALAQPLLLVCAEGYSYREVSELLDVPIGTVMSRIHRARKLLISSLSHQ
EVAEL