Protein Info for Psest_3901 in Pseudomonas stutzeri RCH2

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 790 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 255 to 278 (24 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 335 to 505 (171 residues), 110.7 bits, see alignment E=3.1e-36 PF00990: GGDEF" amino acids 339 to 502 (164 residues), 116.2 bits, see alignment E=1.3e-37 PF00563: EAL" amino acids 525 to 756 (232 residues), 195.2 bits, see alignment E=1.2e-61

Best Hits

KEGG orthology group: None (inferred from 83% identity to psa:PST_0370)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQU5 at UniProt or InterPro

Protein Sequence (790 amino acids)

>Psest_3901 diguanylate cyclase (GGDEF) domain (Pseudomonas stutzeri RCH2)
MTLGKRALLVIFPVILIIQLLASTTAYLTQRASLLGLEQARLEQQLLALQSAYLDYEAFS
RSVLYSIMDSEALLLFLRESDTAFRNDTLGLRIQQSIRSLSNTELSFVSFAVLQPDGEPA
YYFESSLSPFASMDETQRQIVGEARRSSRPGATRYVAHADGGPLLLDTDFILPASSSRPL
PSQRSEAFAVQLAVRPERFLKLKRSLEEEYGAAVEIELHQLPVESGLSAAIELSPALHAR
LTPAASYTAERLQTLALAFIAGGSLICLVSIGLLLWLIRRYVTGPISQLDDQLTDLLQSK
RTALDEPTDGGEIGRLTVNMKTLHERNTEALERIQVISWTDSLTQISNRAHFGVLASAMY
ERCLQSHRRLALLFLDLDNFKQVNDQHGHDAGDTLLRIFAQRVRGLLKRHQLDHPQTDVA
FARLSGDEFAILLLTDAGDGGVDELCAALLDLCRGGFRLEDRLYPVGVSIGTARYPDDAD
SITQLLTRADTAMYQAKAEGKSTAVAFSRELEQRNERIRLIEEQLRALDGDDQLRLVYMP
ALNREGTVVSCEVLLRWHSPILGTVSPGEFIPIAERAGLHSRIDNWVIDRALTEYPKLVE
LFGAEVILAINVSSAQLADDRICSYLLERAAHHGVAPGRIEIELTETYAAELCAGTMDVV
QAIRRAGFRVAIDDFGVGYTSIQQLLEYPADTIKLDMAIITRLTQPDMQQSLSALVAFCH
AQGKRVNAEGVDTMDKQSALLQAGCDLFQGYLISPPRSLAALEDWMAVRNRTQAALRLEQ
RAPRVASQPI