Protein Info for HP15_3773 in Marinobacter adhaerens HP15
Annotation: cytochrome c oxidase assembly protein CtaG/Cox11
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 39% identical to COXZ_SINFN: Cytochrome c oxidase assembly protein CtaG (ctaG) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)
KEGG orthology group: K02258, cytochrome c oxidase subunit XI assembly protein (inferred from 74% identity to maq:Maqu_0064)MetaCyc: 54% identical to cytochrome c oxidase assembly protein (Pseudomonas putida KT2440)
Predicted SEED Role
"Cytochrome oxidase biogenesis protein Cox11-CtaG, copper delivery to Cox1" in subsystem Biogenesis of cytochrome c oxidases
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See E4PI51 at UniProt or InterPro
Protein Sequence (200 amino acids)
>HP15_3773 cytochrome c oxidase assembly protein CtaG/Cox11 (Marinobacter adhaerens HP15) MSNQQANKAGASRSTNRVVGWCLAGVVGMFAFGFAMVPLYDVFCEITGINGKTGGRYEST EVAEADMSRTVKVQFLASNGPGMTWKFRPVVRSVEVHPGEPTTVNFYAENPTAEPMVGQA VPSLAPSEGTLYFHKTECFCFNQQPLEAGESTEMPLIFIVDKDLPAHITKLTLSYTLYDQ GKQPAVTQTSRKDTTTNDNG