Protein Info for Psest_3896 in Pseudomonas stutzeri RCH2

Annotation: arsenite-activated ATPase ArsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF02374: ArsA_ATPase" amino acids 10 to 334 (325 residues), 191.9 bits, see alignment E=2.5e-60 PF01656: CbiA" amino acids 12 to 224 (213 residues), 37.6 bits, see alignment E=2.9e-13 TIGR00345: transport-energizing ATPase, TRC40/GET3/ArsA family" amino acids 13 to 334 (322 residues), 200.1 bits, see alignment E=3e-63 PF13614: AAA_31" amino acids 15 to 153 (139 residues), 39.1 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: K01551, arsenite-transporting ATPase [EC: 3.6.3.16] (inferred from 90% identity to psa:PST_0375)

Predicted SEED Role

"Arsenical pump-driving ATPase (EC 3.6.3.16)" in subsystem Arsenic resistance (EC 3.6.3.16)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQU0 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Psest_3896 arsenite-activated ATPase ArsA (Pseudomonas stutzeri RCH2)
MLLELAAERRVLFFGGKGGVGKTTVAAAAALAQAQAGRRVLLVSTDPAHNLGHLWHRPVG
PQKVRLAPGLDGLELDPELTVQQHLDEVGAALRKLMPAHLAGEVDKHMALSRDAPGMHEA
ALLERIAETVDQGLAEYDLLVFDTAPSGHTARLMALPEMMAAWTEGLLRRQERGSRFAQV
LKNLGQDDRGFGESILGHGGENKEQDRDSRIRIRIRIRSILDRRRERFNRLREVLGDAER
CAFVIVLAAERLPVLETIELHAQLQRAGTPVGALVVNKRSPADAGSFLAERHALEEQHLA
TLRQALGQLPLLELPLLPGDVVGEAALAAFAHRLGGATAAL