Protein Info for Psest_3894 in Pseudomonas stutzeri RCH2

Annotation: Carbon starvation protein, predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 86 to 109 (24 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 328 to 351 (24 residues), see Phobius details amino acids 389 to 408 (20 residues), see Phobius details amino acids 428 to 448 (21 residues), see Phobius details amino acids 458 to 482 (25 residues), see Phobius details amino acids 489 to 507 (19 residues), see Phobius details amino acids 519 to 541 (23 residues), see Phobius details PF02554: CstA" amino acids 3 to 505 (503 residues), 437 bits, see alignment E=6e-135

Best Hits

KEGG orthology group: K06200, carbon starvation protein (inferred from 98% identity to psa:PST_0377)

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GST5 at UniProt or InterPro

Protein Sequence (558 amino acids)

>Psest_3894 Carbon starvation protein, predicted membrane protein (Pseudomonas stutzeri RCH2)
MSAIALLLVGLIAMALGYVFYSKFIAERIYRLDPHYLTPAHTMRDGVDYVPTNKFVLWGH
HFTSVAGAAPIVGPAIAVIWGWGPAFAWVIFGTIFFAGVHDFGALWASARSRGQSVGMLS
GRLIGARGRSLFLVVIFLVLLMVNGAFAAVISNLLVSTPTSVIPVWGAILVALVIGQMIY
RYNMKLLWPSLGGVIVLYALILLGNQYPVALPDEIMGLSAKSVWILLLFVYAAIASLLPV
WVLLQPRDYINGLQLFVGLGLLYLAVLFGAPELVAPAFNQELPADTPSIVPLLFVTIACG
AISGFHGLVASGTTSKQLDKETDARFVGYFGAMGEGMLSLAAIICCTAGFATLTDWQQVY
TAFGSGGVTAFVQGGGTLLANGLGLPAELGGTILAVMAILFAGTTMDTGLRLQRFVIQEA
GELAGMKVNTLIGTLIAVGVCMALAFGAGSDGTGGMVIWPLFGTTNQLLAGLTLAVITVI
LIKLGRSPLYTLVPLVFLLAMSIYALLVQMGQFYRAENWLLLGMDVIILIAALWVTLEAV
IAMRKGRDPAEQAFEAQP