Protein Info for PGA1_c03930 in Phaeobacter inhibens DSM 17395

Annotation: Predicted permeases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 transmembrane" amino acids 12 to 39 (28 residues), see Phobius details amino acids 42 to 63 (22 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 171 to 200 (30 residues), see Phobius details amino acids 204 to 233 (30 residues), see Phobius details amino acids 240 to 261 (22 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details PF01925: TauE" amino acids 17 to 287 (271 residues), 172.8 bits, see alignment E=5.1e-55

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 85% identity to sil:SPO0375)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETT6 at UniProt or InterPro

Protein Sequence (307 amino acids)

>PGA1_c03930 Predicted permeases (Phaeobacter inhibens DSM 17395)
MQIYLPIAEVSVNAFLLLGLGGMVGILSGMFGVGGGFLMTPLLFFIGIPPAVAVATEANQ
IVASSFSGVLAHFRRRTVDIKMGLVLQAGGLLGAALGVVVFNYLKALGQVDLLVKLCYVV
FLGVVGGLMFVESLNAIRKSKASAGAAPAPRRQRGWVHALPFKMRFRTSGLYISVIPPLL
VGVVVGILAAIMGVGGGFIMVPAMIYILGMPTKVVVGTSLFQIILVTAFTTMLHATTNYT
VDIVLAVLLLVGGVIGAQIGTRIGVYLKAEQLRILLALMVIVVCVKLGLDLLLMPSELYS
LGSDGGH