Protein Info for Psest_3887 in Pseudomonas stutzeri RCH2

Annotation: Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 112 to 129 (18 residues), see Phobius details amino acids 135 to 152 (18 residues), see Phobius details amino acids 164 to 187 (24 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details amino acids 315 to 338 (24 residues), see Phobius details amino acids 345 to 362 (18 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 413 to 437 (25 residues), see Phobius details amino acids 458 to 482 (25 residues), see Phobius details PF00361: Proton_antipo_M" amino acids 129 to 421 (293 residues), 198.8 bits, see alignment E=6e-63

Best Hits

KEGG orthology group: K05903, NADH dehydrogenase (quinone) [EC: 1.6.99.5] (inferred from 97% identity to psa:PST_0384)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.5

Use Curated BLAST to search for 1.6.5.3 or 1.6.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRE2 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Psest_3887 Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit (Pseudomonas stutzeri RCH2)
MNWHGLLPLGIVLSSLLPGLVIFALREDQQRLRVTLNLLGVTLKLLLVGGMLYGVSQGSE
YRFSVPLLPGAPLVLQADALALLFVALSSLLWALTTIYAIGYLEDSPLRSRFFGYFSLCV
SATVGLALAGNLVSFLLFYELLTLATFPLVVHRGTPESLRAGRVYLAYTVGGGTLVLMGV
ALLHSLAGTPDFQAAGYLLEQVGEHDVGLRVAFALLILGLGVKAALIPLHGWLPQAMVAP
APVSALLHAVAVVKAGAFGIVRVVYDVFGAEALTQLDLTKPLLWLAAATILYGSLRALQQ
QELKKRLAYSTISQVSYVTLGVALLGPIAAVGGLVHLVHQGLMKVTLFYCAGNFAETLGI
HRIREMDGVGRRMPWTMTAFSIGALGMIGIPPIAGFISKWTLGLGALEVGQDWVLLVLLG
SALLNAAYFLPLLWRGWFAEPADWHENRWAEERFETHWMLLLPPVITALLSLLVGLLAAT
ALSPLGWSQLIVEREFAI