Protein Info for PGA1_262p02200 in Phaeobacter inhibens DSM 17395

Annotation: molybdenum import ATP-binding protein ModC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR02142: molybdate ABC transporter, ATP-binding protein" amino acids 3 to 352 (350 residues), 397.5 bits, see alignment E=2.9e-123 PF00005: ABC_tran" amino acids 21 to 160 (140 residues), 104.4 bits, see alignment E=7.8e-34 PF03459: TOBE" amino acids 292 to 352 (61 residues), 41.6 bits, see alignment E=1.2e-14

Best Hits

Swiss-Prot: 49% identical to MODC_RHILO: Molybdenum import ATP-binding protein ModC (modC) from Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 67% identity to sil:SPO0697)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWU4 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PGA1_262p02200 molybdenum import ATP-binding protein ModC (Phaeobacter inhibens DSM 17395)
MLDVRLTHQLGQLALDVDFSAPAGVTVLFGRSGAGKTTVVNAVAGLLQPQTGKICLGSRV
VLDTEAGIDTPPHRRRIGYIFQDARLFPHMSVSKNLLYGQRFKTRKRAVTTFDTVVEMLG
LGALLNRHPANLSGGEKQRVAIGRALLSAPDMILADEPLAALDETRKAEILPYLERLRDE
ITLPILYVTHSVAEVARLATTVVVLQDGRCIRSGPADLVLADPTIMPTGVRAAGAILQAT
VQQHHADGLSELNAGGLALFLPRVPHPPGHAVRVRISAHEVILSRQRPVGLSALNILPGR
VTALRSGDGPGIMISLQTSAGALLARVTRRSAVALDLAIGTECHAIVKSVSIAPEDVGGT
RTG