Protein Info for Psest_3883 in Pseudomonas stutzeri RCH2

Annotation: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00072: Response_reg" amino acids 3 to 112 (110 residues), 93.1 bits, see alignment E=1.3e-30 PF00486: Trans_reg_C" amino acids 145 to 220 (76 residues), 82.2 bits, see alignment E=2.3e-27

Best Hits

Swiss-Prot: 53% identical to PHOP_SALTI: Virulence transcriptional regulatory protein PhoP (phoP) from Salmonella typhi

KEGG orthology group: K07660, two-component system, OmpR family, response regulator PhoP (inferred from 99% identity to psa:PST_0389)

Predicted SEED Role

"Transcriptional regulatory protein PhoP" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNM2 at UniProt or InterPro

Protein Sequence (225 amino acids)

>Psest_3883 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain (Pseudomonas stutzeri RCH2)
MKVLVVEDEALLRHHLLTRLGESGHIVDAVPNAEEALYQTHEFNHDLAVIDLGLPGISGL
DLIRQLRSRGKVFPILILTARGNWQDKVEGLAAGADDYVVKPFQFEELEARLNALLRRSS
GFTQATIEAGPLLLDLNRKQAMANGEPLALTAYEYRILEYLMRHQQQVVAKERLMEQLYS
GDEERDPNVIEVLVGRLRRKLEAQCAMKPIETVRGLGYLFTERCR